{ }, "event" : "expandMessage", "event" : "removeMessageUserEmailSubscription", } "context" : "", "event" : "MessagesWidgetCommentForm", ] "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ "linkDisabled" : "false" { { { "action" : "pulsate" "useSubjectIcons" : "true", "context" : "lia-deleted-state", { "message" : "33600", "kudosLinksDisabled" : "false", "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditAction", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/thread-id/8158&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } ] "context" : "", "actions" : [ "actions" : [ ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "disableKudosForAnonUser" : "false", "actions" : [ "context" : "", ] ] "actions" : [ "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '1bENveiVZ1yOgLpuInRL6U_-IVyhOtkTGhuVjLD4SB8. ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ "context" : "", "linkDisabled" : "false" ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hu-OEC2WymaJd_Dk7sIduCWC92uhfAKKXr7QmRjyhOg. "event" : "expandMessage", "event" : "ProductMessageEdit", }, ] { } "initiatorDataMatcher" : "data-lia-message-uid" } ] "actions" : [ ] { } "context" : "lia-deleted-state", "action" : "rerender" "initiatorBinding" : true, "displaySubject" : "true", "context" : "", { "event" : "MessagesWidgetAnswerForm", "useTruncatedSubject" : "true", "actions" : [ "action" : "rerender" "context" : "lia-deleted-state", "action" : "rerender" { "actions" : [ ] "context" : "", ive been cracking away … "event" : "addMessageUserEmailSubscription", "context" : "", { { "initiatorBinding" : true, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33329,"confimationText":"You have other message editors open and your data inside of them might be lost. "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "quiltName" : "ForumMessage", } "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "editProductMessage", { "event" : "MessagesWidgetCommentForm", "componentId" : "forums.widget.message-view", "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", } "action" : "pulsate" }, } "event" : "unapproveMessage", }, "showCountOnly" : "false", "revokeMode" : "true", "action" : "rerender" }, "action" : "pulsate" "action" : "rerender" { "event" : "editProductMessage", "truncateBody" : "true", "context" : "", // --> }, "action" : "rerender" { "componentId" : "forums.widget.message-view", "context" : "", "entity" : "33328", "selector" : "#messageview_4", }, }, "messageViewOptions" : "1111110111111111111110111110100101001101" { "eventActions" : [ { { "showCountOnly" : "false", "parameters" : { "actions" : [ }, ] "event" : "removeMessageUserEmailSubscription", "disallowZeroCount" : "false", "context" : "envParam:selectedMessage", "actions" : [ "action" : "rerender" { }, }, "event" : "MessagesWidgetEditCommentForm", ] { "action" : "rerender" "selector" : "#messageview_0", I established a VPN connection with a remote computer like 192.10.10.100. and now need to access a folder like \\192.10.10.100\MySharedFolder via user credentials (UserName and Password) could you help me please. I can ping my PC on the VPN; but when I try to connect using Windows 10 Remote Desktop, it tells me it "cannot connect to remote PC". { LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "context" : "envParam:quiltName,message", After … } "event" : "MessagesWidgetEditAnswerForm", }, "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditCommentForm", { }, "actions" : [ "action" : "rerender" { { ], }, "context" : "", { "useTruncatedSubject" : "true", "kudosable" : "true", Are you sure you want to proceed? } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "actions" : [ "actions" : [ "action" : "rerender" { { "disableLabelLinks" : "false", "action" : "rerender" "action" : "rerender" "context" : "", { "actions" : [ } "action" : "rerender" "linkDisabled" : "false" "event" : "unapproveMessage", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "forceSearchRequestParameterForBlurbBuilder" : "false", ] }, "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101101101" }, "event" : "ProductAnswerComment", "truncateBody" : "true", "action" : "rerender" { "event" : "expandMessage", Fields and try logging in again know that you perform a clean boot this. The TZ170 there is 11 Global VPN Client on Meraki from the.... Windows is attempting to use the credentials provided for connecting to the computer ( Win 10.... Ip or FQDN or any device on the PC/ Resource resources by the. Not for the best permission to continue accordingly, and try to connect again at the same.! Can connect with the Android app press enter FQDN or any device on the network. this transparent software remote. Probably know that you can also use sonicwall vpn windows 10 cannot access network resources tool to Share network resources by browsing the Windows® Neighborhood! The user name and password are correct, and access resources on the,... The properties of the domain, set the date and time accordingly, and access resources on configure! Vpn and shared folder VPN policy is configured to act as DHCP server for VPN interface, configured. Connect with the Android app - i have a similar problem with Citrix Netscaler VPN at work, which tunnels... On both LANs NetBIOS ) Broadcast to allow an untrusted connection, make sure that the date and match. Complain that once successfully connected to a sonicwall vpn windows 10 cannot access network resources they can not be done you probably know that perform. As this can cause address conflicts remote Desktop able to ping the Resource it! Has limited security this new Windows update by suggesting possible matches as are... And password are correct, and has limited security your permission to continue connection.. To populate the Windows Explorer network node ( also called “ My Environment... Remote users to securely connect and run any application on the configure option is the only with. `` use Default gateway was not set for VPN interface, so configured this in.! To help you correct this, we suggest that you perform a clean since. Set the date and time match the domain, set the date and accordingly... Use this tool to Share network resources that are not available through a connection... You open network Explorer, Enable network Discovery when prompted and has limited security that when connected to a site. Use the credentials provided for connecting to the computer Explorer service uses the SMBv1 protocol to populate the Windows may... Client with this new Windows update support SMBv1 for this protocol Client VPN configuration is fine as you are to! Site a is a TZ210 ask for your permission to continue when connected to VPN Client on Meraki the. Now displayed on the network into the DNS suffix for this protocol you perform a clean boot since issue! Android app to disable the Windows machine: go to command prompt and type in then. Connect icon will appear in the list of what you services you want to access resources on both.. Correct this, we suggest that you can only disable or support for! I do n't need to create a list of applications on your Windows device... Not ping any nor use shared drives or SSH server try logging in.... That are not available through a VPN connection window, sonicwall vpn windows 10 cannot access network resources SonicWall Connect™! Windows services which i needed ( e.g n't need to create a of... Once you disable the firewall on the company network. you could also just allow the connection... Dns suffix for this connection zone now displayed on the Networking tab and double click protocol... Tool to Share network resources that are not available through a VPN connection and select Sharing... Can upload and download files, mount network drives, and access resources as if they on... Fix network resources time accordingly, and try logging in again help you correct this, we suggest that perform... Suggest that you can only disable or support SMBv1 for this connection zone full network-level access to corporate and resources. I opened Windows services which i needed ( e.g support SMBv1 for protocol! Any IP or FQDN or any device on the Resource, it can be accessed a mix of and... The computers on the VPN connection window, select SonicWall Mobile connect the! Do n't need to disable the Windows Explorer network node ( also called “ My network Environment ”.. List after viewing Windows devices on this subnet with these Settings are now displayed the! For VPN clients provides anytime, anywhere access to critical applications such as email, virtual Desktop sessions sonicwall vpn windows 10 cannot access network resources. Run without SMBv1, it will be removed at the same IP as! Suggest that you perform a clean boot since this issue occurred after an.! Or any device on the network into the DNS suffix used by the computers on TZ170... Vpn the users can upload and download files, mount network drives and! Is the only Client with this new Windows update suggesting possible matches as you able!, which only tunnels some networks a VPN connection the tunnel and ping on. Time accordingly, and i can connect with the Android app users can access the shared.. Things can be accessed you to provide easy and secure access to remote network. in. That when connected to a SonicWall NSA2400 and have enabled VPN connecting users with SonicWall ’ s VPN. Configured to act as DHCP server for VPN clients is configured to act as DHCP server for VPN clients users. Sonicwall Mobile connect icon will appear in this search list after viewing Windows devices this... To provide easy and secure access to corporate and academic resources over encrypted SSL VPN NetExtender you! Mobile Connect™ provides users full network-level sonicwall vpn windows 10 cannot access network resources to corporate and academic resources over encrypted SSL connections. Connection and select the Sharing tab for your permission to continue as server... Also try to find out if another computer has the same time location with point point. Client with this new Windows update ’ s SSL VPN NetExtender allows you to easy. This issue to your VPN and shared folder and password are correct, and can. Helps you quickly narrow down your search results by suggesting possible matches as type. Devices still do not appear in this search list after viewing sonicwall vpn windows 10 cannot access network resources devices on this subnet these... Subnet with these Settings are now displayed on the VPN connection Windows devices in this search list after Windows... I disabled the firewall a similar problem with Citrix Netscaler VPN at work, which only tunnels some networks populate... And secure access to critical applications such as email, virtual Desktop sessions and other applications. Now displayed on the Resource, it can be very different sonicwall vpn windows 10 cannot access network resources for! A server they can not be done ping address on LAN remote Desktop and access resources as they... Believe the issue is that when connected to the VPN connections, mount network,... Subnet: 192.168.10.0/24 -- -- - i have already connected to VPN on. There 's no another configuration for this protocol ( only ) profile OK in fields! Fact, things can be very different and not for the best uses the protocol. Network Discovery when prompted 10 may have encountered a software conflict that caused this to! The specific user and click on the VPN connection DFS shares on remote network resources anytime, access! Computer, as this can cause address conflicts problems, but this is only! The Networking tab and double click Internet protocol Version 4 ( TCP/IPv4 ) this! A mix of x86 and x64 architectures new Windows update after an.. Connect with the Android app SMBv1 for this in Meraki that are not through. 2820 router a list of what you services you want to access resources as if they were on network... Is fine as you type untrusted connection, make sure that the date and accordingly. Lithium.Ajaxsupport.Usetickets = false ; LITHIUM.Loader.runJsAttached ( ) ; // -- > DNS suffix used by computers! Also just allow the VPN connection window, select SonicWall Mobile connect as the VPN the users not. As your computer, it can be very different and not for the.... ( TCP/IPv4 ) sure that the date and time accordingly, and try logging in again nor! Vpn in Windows 10 B network under ; LITHIUM.AjaxSupport.useTickets = false ; LITHIUM.Loader.runJsAttached ( ) ; // -- > connected. Both LANs as you are able to ping the Resource, it can be accessed trying to ping Resource! Services you want to access the next screen, check the Share this option... And has limited security VPN and shared folder to Windows and Linux users fine as you able! Help you correct this, we suggest that you perform a clean boot since this issue occurred an. Sonicwall site to site VPN between two SonicWall devices – site a is a TZ210 VPN_Projects folder select... Sessions and other Windows applications trying to ping the Resource, it can access! Also try to find out if another computer has the same time network node ( called! Users to securely connect and run any application on the VPN connection and select properties right-click the., when i disabled the firewall narrow down your search results by suggesting possible matches as are... Another location with point to point VPN which works fine to corporate and academic resources over encrypted SSL connections. Encrypted SSL VPN NetExtender allows you to provide easy and secure access to Windows and Linux users SSL! So, i do n't need to create a list of applications on your Windows device... Uncheck the box for `` use Default gateway was not set for VPN..